Webgenome browser: aa seq: 1138 aa aa seq db search mkfqlfclfaylwqavfvaaagnspnfvqgdqgsvsvkatngcpcldfsfhaqntgtiqy nvdvtdvkwvqdniytvtihtygskqiplkslwslkiigvnspdggtfqlygfnektfki Webflocculation protein FLO11-like. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. LOC106543195 flocculation protein FLO11-like [] Gene ID: 106543195, updated on 2-Sep-2024 ...
JoF Free Full-Text Phenylalanine Promotes Biofilm Formation of ...
WebFLO11 1 Systematic Name YIR019C SGD ID SGD:S000001458 ... (flocculin); required for pseudohyphal and invasive growth, flocculation, and biofilm formation; major determinant of colony morphology; QTL that controls chronological life span; ... List of external identifiers for the protein from various database sources. WebDec 1, 1996 · Flocculation is abolished when FLO11 is disrupted. The product of STA1 also is shown to have flocculating activity. When a green fluorescent protein fusion of FLO11 was expressed from the FLO11 promoter on a single-copy plasmid, fluorescence was observed in vivo at the periphery of cells. creighton nebraska volleyball tickets
Flocculation protein structure and cell-cell adhesion …
WebJul 25, 2006 · In nature, Saccharomyces yeasts manifest a number of adaptive responses to overcome adverse environments such as filamentation, invasive growth, flocculation and adherence to solid … WebLo WS and Dranginis AM (1996) FLO11, a yeast gene related to the STA genes, encodes a novel cell surface flocculin. J Bacteriol 178 (24):7144-51 PMID: 8955395. Rupp S, et al. … FLO11 / YIR019C Interactions Interaction annotations are curated by BioGRID and … Expression - FLO11 SGD Phenotype - FLO11 SGD Contains experimentally-derived protein half-life data obtained using stable … Protein; Gene Ontology; Phenotype; Disease; Interactions; Regulation; … FLO11 / YIR019C Regulation Transcriptional regulation information for … Disease - FLO11 SGD FLO11 / YIR019C Gene Ontology GO Annotations consist of four mandatory … WebJul 18, 2010 · The Flo11p protein has the same domain structure as the other Flo proteins, but has a totally different amino acid sequence. The protein is responsible for … creighton nebraska public library